PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003876.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 369aa    MW: 38162.2 Da    PI: 7.7166
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003876.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.86.1e-18264299136
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 
                 C++C + kTp+WR gp g+ktLCnaCG+++++ +l+
  Do003876.1 264 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLM 299
                 ********************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.3E-16258308IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.4E-13262296IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.227262294IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.55E-14262322No hitNo description
CDDcd002023.01E-13263310No hitNo description
PfamPF003201.3E-15264299IPR000679Zinc finger, GATA-type
PROSITE patternPS003440264289IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MASEWEMAMG VELGMGMGTY HGHHNASSIT AAPMSSHHSG GTSYSAAHHH HYYGMPPMGD  60
AMRVDELLDL STGAGAHEFF PTAAAAAATD NGHHHSAAMG EPSPTGNSSD HQTSILSFAD  120
EFYIPSEEAA ELEWLSKFVD DSYSDMPNYS SAAHAAMAAA AANAAGNGGG NSAGQDSCVT  180
AVPGRGARSK RSRATAAAAA AWHSLVPRPV SQSSPSSSSC SSSDFPSSNK PGRPNGANGS  240
RGKKSPGPGG AAGEVGMEGG VRRCTHCASE KTPQWRTGPL GPKTLCNACG VRFKSGRLMP  300
EYRPAASPTF VLTQHSNSHR KVMELRRQKE LILIRGSHRD AAAAAAAASA AVGSGGPRPE  360
LMFRDYGVC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0688040.0BT068804.1 Zea mays full-length cDNA clone ZM_BFb0383N16 mRNA, complete cds.
GenBankBT0877980.0BT087798.1 Zea mays full-length cDNA clone ZM_BFb0206G21 mRNA, complete cds.
GenBankEU9562060.0EU956206.1 Zea mays clone 1559028 GATA transcription factor 9 mRNA, complete cds.
GenBankKJ7269570.0KJ726957.1 Zea mays clone pUT3655 C2C2-GATA transcription factor (GATA28) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983678.10.0PREDICTED: GATA transcription factor 2-like
SwissprotO497417e-61GATA2_ARATH; GATA transcription factor 2
TrEMBLK4ABL60.0K4ABL6_SETIT; Uncharacterized protein
STRINGSi036273m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.17e-44GATA transcription factor 2